Welcome to E-Tronics
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Waterproof Mountain Bike Rear Shelf Bag
Waterproof Mountain Bike Rear Shelf Bag
Waterproof Mountain Bike Rear Shelf Bag
Waterproof Mountain Bike Rear Shelf Bag
Waterproof Mountain Bike Rear Shelf Bag
Waterproof Mountain Bike Rear Shelf Bag
Waterproof Mountain Bike Rear Shelf Bag

Waterproof Mountain Bike Rear Shelf Bag

Product Code: CJZX113286301AZ
Product Condition: New
weight: 500.0g
$0.00 inc. tax
 Add to Cart
Description

Product Information：

Material: 600D Oxford cloth ancient rule film PU+cotton velvet bottom PU reflective

Function: travel bag
Model: Reflective shelf bag
Size: reflective version


Packing List：

Travel bag*1


Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i