Welcome to E-Tronics
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Retro Style 18K Gold Diamond Double Flower And Leaf Brushed Carving Gold Ear-ring Clip
Retro Style 18K Gold Diamond Double Flower And Leaf Brushed Carving Gold Ear-ring Clip
Retro Style 18K Gold Diamond Double Flower And Leaf Brushed Carving Gold Ear-ring Clip
Retro Style 18K Gold Diamond Double Flower And Leaf Brushed Carving Gold Ear-ring Clip
Retro Style 18K Gold Diamond Double Flower And Leaf Brushed Carving Gold Ear-ring Clip
Retro Style 18K Gold Diamond Double Flower And Leaf Brushed Carving Gold Ear-ring Clip
Retro Style 18K Gold Diamond Double Flower And Leaf Brushed Carving Gold Ear-ring Clip
Retro Style 18K Gold Diamond Double Flower And Leaf Brushed Carving Gold Ear-ring Clip
Retro Style 18K Gold Diamond Double Flower And Leaf Brushed Carving Gold Ear-ring Clip
Retro Style 18K Gold Diamond Double Flower And Leaf Brushed Carving Gold Ear-ring Clip
Retro Style 18K Gold Diamond Double Flower And Leaf Brushed Carving Gold Ear-ring Clip

Retro Style 18K Gold Diamond Double Flower And Leaf Brushed Carving Gold Ear-ring Clip

Product Code: CJST177835501AZ
Product Condition: New
weight: 11.0g
$0.00 inc. tax
 Add to Cart
Description

Product information:
Treatment Process: Diamond
Type: earrings
Inlaid material: Gold/K gold inlaid gem
Style: Women's
Material: Gold
Purity: double flower and leaf brushed carved gold earrings
Shape: Leaves
Popular elements: metal, pastoral, retro, flocking
Style: Retro


Packing list:
Ear-ring Clip*1pair


Product Image:


Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i