Welcome to E-Tronics
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Remote Control Tank Soft Bomb Armored Rc Toy Car
Remote Control Tank Soft Bomb Armored Rc Toy Car
Remote Control Tank Soft Bomb Armored Rc Toy Car
Remote Control Tank Soft Bomb Armored Rc Toy Car
Remote Control Tank Soft Bomb Armored Rc Toy Car
Remote Control Tank Soft Bomb Armored Rc Toy Car
Remote Control Tank Soft Bomb Armored Rc Toy Car
Remote Control Tank Soft Bomb Armored Rc Toy Car

Remote Control Tank Soft Bomb Armored Rc Toy Car

Product Code: CJJT150601501AZ
Product Condition: New
weight: 2000.0g
$0.00 inc. tax
 Add to Cart
Description

Product information:
Type: wireless remote control, charging
Toy material: plastic
Remote control method: handle
Color: orange (single remote control), blue (single remote control)
Applicable age: (7-14 years old)



Packing list:
Plastic toys x1



Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i