Welcome to E-Tronics
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
PawHut Foldable Pet Bike Trailer Dog Cat Travel Bicycle Carrier, Red
PawHut Foldable Pet Bike Trailer Dog Cat Travel Bicycle Carrier, Red
PawHut Foldable Pet Bike Trailer Dog Cat Travel Bicycle Carrier, Red
PawHut Foldable Pet Bike Trailer Dog Cat Travel Bicycle Carrier, Red
PawHut Foldable Pet Bike Trailer Dog Cat Travel Bicycle Carrier, Red
PawHut Foldable Pet Bike Trailer Dog Cat Travel Bicycle Carrier, Red
PawHut Foldable Pet Bike Trailer Dog Cat Travel Bicycle Carrier, Red

PawHut Foldable Pet Bike Trailer Dog Cat Travel Bicycle Carrier, Red

Product Code: B4-0003-007
Product Condition: New
$189.23 inc. tax
 Add to Cart
Description
PawHut Foldable Pet Bike Trailer Dog Cat Travel Bicycle Carrier, Red
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i