Welcome to E-Tronics
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Nb F80 Computer Monitor Stand Desktop Lcd Dual Screen Telescopic Rotating Lifting Desktop Shelf F100
Nb F80 Computer Monitor Stand Desktop Lcd Dual Screen Telescopic Rotating Lifting Desktop Shelf F100
Nb F80 Computer Monitor Stand Desktop Lcd Dual Screen Telescopic Rotating Lifting Desktop Shelf F100
Nb F80 Computer Monitor Stand Desktop Lcd Dual Screen Telescopic Rotating Lifting Desktop Shelf F100
Nb F80 Computer Monitor Stand Desktop Lcd Dual Screen Telescopic Rotating Lifting Desktop Shelf F100
Nb F80 Computer Monitor Stand Desktop Lcd Dual Screen Telescopic Rotating Lifting Desktop Shelf F100
Nb F80 Computer Monitor Stand Desktop Lcd Dual Screen Telescopic Rotating Lifting Desktop Shelf F100
Nb F80 Computer Monitor Stand Desktop Lcd Dual Screen Telescopic Rotating Lifting Desktop Shelf F100
Nb F80 Computer Monitor Stand Desktop Lcd Dual Screen Telescopic Rotating Lifting Desktop Shelf F100
Nb F80 Computer Monitor Stand Desktop Lcd Dual Screen Telescopic Rotating Lifting Desktop Shelf F100

Nb F80 Computer Monitor Stand Desktop Lcd Dual Screen Telescopic Rotating Lifting Desktop Shelf F100

Product Code: CJVR106925301AZ
Product Condition: New
weight: 500.0g
$0.00 inc. tax
 Add to Cart
Description

Product information:

Control method: microcomputer type

Color: A style [17-30 inch 2-9KG] standard style

 














Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i